P05452 TETN_HUMAN
Gene name: CLEC3B
Protein name: Tetranectin
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- protein maturation GO:0051604
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NVV0 | TMEM38B | 0.78433 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q96A08 | H2BC1 | 0.77881 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 3 | Q9H0A0 | NAT10 | 0.75071 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 4 | P62424 | RPL7A | 0.74156 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q9BU68 | PRR15L | 0.7273 | |
| 6 | Q16363 | LAMA4 | 0.71266 | anatomical structure development GO:0048856 cell adhesion GO:0007155 embryo development GO:0009790 ... |
| 7 | Q5BJF6 | ODF2 | 0.70398 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 8 | P35268 | RPL22 | 0.69815 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q9Y2R4 | DDX52 | 0.69441 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 10 | Q8ND07 | BBOF1 | 0.68944 | cellular component assembly GO:0022607 |
20 40 60 80 100 AA: MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCIS STMI: SSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. DO_IUPRED2A: .........................DDD.DDDD................................................................... DO_SPOTD: DDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDD............................................................. CONSENSUS: DDDDDDDDDDDDDDDDDD............................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDD...................................................... RICH_[K]: KpKKivnaKK RICH_[KV]: KpKKiVnaKKdVV RICH_MOBI_[K]: KpKKivnaKKdvvntK RICH_MOBI_[KN]: NaKKdvvNtK RICH_MOBI_[KV]: KpKKiVnaKKdVVntK RICH_fLPS_MOBI_[K]: pptqKpKKivnaKKdvvntK
120 140 160 180 200 AA: RGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFG STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .DDDDD.............................................................................................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: IV STMI: DO_DISOPRED3: .. DO_IUPRED2A: .. DO_SPOTD: .. CONSENSUS: .. CONSENSUS_MOBI: ..