Q96A08 H2B1A_HUMAN
Gene name: H2BC1
Protein name: Histone H2B type 1-A
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- immune system process GO:0002376
- protein maturation GO:0051604
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P42127 | ASIP | 0.97172 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | P24844 | MYL9 | 0.93105 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 3 | Q9Y324 | FCF1 | 0.92703 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 4 | Q9NRQ5 | SMCO4 | 0.9161 | |
| 5 | Q92963 | RIT1 | 0.91332 | signal transduction GO:0007165 |
| 6 | Q07325 | CXCL9 | 0.89533 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 7 | Q6NW29 | RWDD4 | 0.89484 | |
| 8 | A0A1B0GTY4 | TEX50 | 0.8913 | |
| 9 | Q9Y291 | MRPS33 | 0.89105 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 10 | Q1ED39 | KNOP1 | 0.87026 |
20 40 60 80 100 AA: MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: ..DDD................DDDDDDDDDDDD................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... RICH_[K]: KgatisKKgfKKavvKtqKKegKKrK RICH_fLPS_[K]: KKgfKKavvKtqKKegKKrK RICH_MOBI_[K]: KgatisKKgfKKavvKtqKKegKK RICH_MOBI_[KV]: KKgfKKaVVKtqKKegK RICH_fLPS_MOBI_[K]: KgatisKKgfKKavvKtqKKegKK
120 AA: RLLLPGELAKHAVSEGTKAVTKYTSSK STMI: DO_DISOPRED3: ..........................D DO_IUPRED2A: .......................DD.. DO_SPOTD: ...................DDDDDDDD CONSENSUS: .......................DDDD CONSENSUS_MOBI: ...........................