P35268 RL22_HUMAN
Gene name: RPL22
Protein name: 60S ribosomal protein L22
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N300 | SVBP | 0.82432 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
| 2 | Q92664 | GTF3A | 0.80479 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 3 | Q9BU68 | PRR15L | 0.7824 | |
| 4 | Q9UN37 | VPS4A | 0.77711 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 5 | P42127 | ASIP | 0.75868 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q96A08 | H2BC1 | 0.74901 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 7 | O60519 | CREBL2 | 0.74755 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 8 | Q9NVV0 | TMEM38B | 0.74718 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | P25189 | MPZ | 0.69981 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell-cell signaling GO:0007267 |
| 10 | P05452 | CLEC3B | 0.69815 | anatomical structure development GO:0048856 protein maturation GO:0051604 transport GO:0006810 ... |
20 40 60 80 100 AA: MAPVKKLVVKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDD...................................................................................... RICH_[K]: KKlvvKggKKKK RICH_[KV]: VKKlVVKggKKKK RICH_fLPS_[K]: apvKKlvvKggKKKK RICH_MOBI_[K]: KKlvvKggKK RICH_MOBI_[KV]: VKKlVVKggKK
120 AA: RVVANSKESYELRYFQINQDEEEEEDED STMI: DO_DISOPRED3: ...................DDDDDDDDD DO_IUPRED2A: ....................D.DDDDDD DO_SPOTD: ...................DDDDDDDDD CONSENSUS: ...................DDDDDDDDD CONSENSUS_MOBI: ..........................DD