P06730 IF4E_HUMAN
Gene name: EIF4E
Protein name: Eukaryotic translation initiation factor 4E
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- mitotic cell cycle GO:0000278
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- response to stress GO:0006950
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96KC9 | CABS1 | 0.77718 | reproduction GO:0000003 |
| 2 | Q6UY09 | CEACAM20 | 0.77133 | immune system process GO:0002376 |
| 3 | Q8N687 | DEFB125 | 0.74573 | immune system process GO:0002376 response to stress GO:0006950 |
| 4 | O94817 | ATG12 | 0.72022 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | O60462 | NRP2 | 0.71504 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 6 | Q4ZJI4 | SLC9B1 | 0.69893 | homeostatic process GO:0042592 reproduction GO:0000003 transmembrane transport GO:0055085 ... |
| 7 | O75121 | MFAP3L | 0.68562 | |
| 8 | Q9Y493 | ZAN | 0.68357 | cell adhesion GO:0007155 reproduction GO:0000003 |
| 9 | P22105 | TNXB | 0.68344 | cell adhesion GO:0007155 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 10 | Q96J77 | TPD52L3 | 0.67284 |
20 40 60 80 100 AA: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... RICH_[PT]: TvePeTTPTPnPPTTeeekT RICH_[E]: EpEttptpnppttEEEktEsnqEvanpE RICH_[P]: PettPtPnPP RICH_[T]: TvepeTTpTpnppTTeeekT RICH_[EN]: EsNqEvaNpE RICH_[EP]: EPEttPtPnPPttEEEktEsnqE RICH_[ET]: TvEpETTpTpnppTTEEEkTEsnqE RICH_fLPS_[T]: TvepeTTpTpnppTTeeekT RICH_MOBI_[PT]: TvePeTTPTPnPPTT RICH_MOBI_[E]: EpEttptpnppttEEEktEsnqE RICH_MOBI_[P]: PettPtPnPP RICH_MOBI_[T]: TvepeTTpTpnppTTeeekT RICH_MOBI_[ET]: TvEpETTpTpnppTTEEEkTEsnqE RICH_fLPS_MOBI_[T]: TvepeTTpTpnppTTeeekT
120 140 160 180 200 AA: MWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSH STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: ADTATKSGSTTKNRFVV STMI: DO_DISOPRED3: ................. DO_IUPRED2A: ................. DO_SPOTD: ....DDDDDDDDDD.D. CONSENSUS: ................. CONSENSUS_MOBI: .................