O94817 ATG12_HUMAN

Gene name: ATG12
Protein name: Ubiquitin-like protein ATG12

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q4ZJI4 SLC9B1 0.76013 homeostatic process GO:0042592
reproduction GO:0000003
transmembrane transport GO:0055085
...
2 A0A1B0GTD5 TEX49 0.74831
3 Q6UY09 CEACAM20 0.73549 immune system process GO:0002376
4 P06730 EIF4E 0.72022 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
5 A8MW95 BECN2 0.71769 catabolic process GO:0009056
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
6 Q96J77 TPD52L3 0.71122
7 P13591 NCAM1 0.69742 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
8 Q96KC9 CABS1 0.69385 reproduction GO:0000003
9 Q8WXF5 CRYGN 0.68891 anatomical structure development GO:0048856
nervous system process GO:0050877
10 Q8N687 DEFB125 0.66388 immune system process GO:0002376
response to stress GO:0006950

                                           20                  40                  60                  80                 100
AA:                      MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................
DO_IUPRED2A:             .DDD....DDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D.................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D................................................
RICH_[PT]:                                     TdvsPeTTTPePPssaavsP                                                          
RICH_[T]:                            TsiaaggeglTdvspeTTT                                                                     
RICH_[EP]:                                         PEtttPEPPssaavsPgtEEP                                                     
RICH_[ET]:                                          ETTTpEppssaavspgTEE                                                      
RICH_MOBI_[T]:                       TsiaaggeglTdvspeTTT                                                                     
RICH_MOBI_[ET]:                                     ETTTpEppssaavspgTEE                                                      

                                          120
AA:                      FIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
STMI:                                                            
DO_DISOPRED3:            ........................................
DO_IUPRED2A:             ........................................
DO_SPOTD:                ........................................
CONSENSUS:               ........................................
CONSENSUS_MOBI:          ........................................