P09430 STP1_HUMAN

Gene name: TNP1
Protein name: Spermatid nuclear transition protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- protein maturation GO:0051604
- reproduction GO:0000003
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P15692 VEGFA 0.83775 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
2 Q6UXX9 RSPO2 0.81163 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
3 P42766 RPL35 0.7941 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
4 P55160 NCKAP1L 0.77557 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
5 Q13733 ATP1A4 0.77231 circulatory system process GO:0003013
homeostatic process GO:0042592
reproduction GO:0000003
...
6 Q8N609 TRAM1L1 0.77129 protein targeting GO:0006605
protein transport GO:0015031
transmembrane transport GO:0055085
...
7 Q9H930 SP140L 0.76401
8 P0DPH9 CXorf51B 0.7567
9 Q6UWX4 HHIPL2 0.74814
10 Q9NY93 DDX56 0.72672 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40     
AA:                      MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
STMI:                                                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD.D...................DD...DDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[RS]:                StSRklkShgmRRSkSRS                                    
RICH_[RY]:                                               YRkgnlksRkRgddanRnYR   
RICH_[K]:                     KlKshgmrrsKsrsphKgvKrggsKrKyrKgnlKsrK             
RICH_[R]:                    RklkshgmRRsksR       RggskRkyRkgnlksRkRgddanRnyR   
RICH_[S]:                 StSrklkShgmrrSkSrS                                    
RICH_[GK]:                         GmrrsKsrsphKGvKrGGsKrK                       
RICH_[GR]:                         GmRRsksRsphkGvkRGG                           
RICH_[KR]:                   RKlKshgmRRsKsRsphK  KRggsKRKyRKgnlKsRKRgddanR      
RICH_[KY]:                                              KYrKgnlKsrKrgddanrnY    
RICH_[NR]:                                                       RkRgddaNRN     
RICH_fLPS_[K]:                          KsrsphKgvKrggsKrKyrKgnlKsrK             
RICH_MOBI_[RS]:           StSRklkShgmRRSkSRS                                    
RICH_MOBI_[RY]:                                          YRkgnlksRkRgddanRnYR   
RICH_MOBI_[K]:                KlKshgmrrsKsrsphKgvKrggsKrKyrKgnlKsrK             
RICH_MOBI_[N]:                                               NlksrkrgddaNrN     
RICH_MOBI_[R]:               RklkshgmRRsksR       RggskRkyRkgnlksRkRgddanRnyR   
RICH_MOBI_[GK]:                    GmrrsKsrsphKGvKrGGsKrK                       
RICH_MOBI_[GR]:                    GmRRsksRsphkGvkRGG                           
RICH_MOBI_[KR]:              RKlKshgmRRsKsRsphK  KRggsKRKyRKgnlKsRKRgddanR      
RICH_MOBI_[KY]:                                         KYrKgnlKsrKrgddanrnY    
RICH_MOBI_[MR]:          MstsRklkshgMRRsksR                                     
RICH_MOBI_[MS]:          MStSrklkShgMrrSkSrS                                    
RICH_MOBI_[NR]:                                                  RkRgddaNRN     
RICH_fLPS_MOBI_[K]:                     KsrsphKgvKrggsKrKyrKgnlKsrK