P42766 RL35_HUMAN

Gene name: RPL35
Protein name: 60S ribosomal protein L35

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- ribosome biogenesis GO:0042254
- translation GO:0006412
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P55160 NCKAP1L 0.91419 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
2 Q13733 ATP1A4 0.8511 circulatory system process GO:0003013
homeostatic process GO:0042592
reproduction GO:0000003
...
3 Q6UXX9 RSPO2 0.84603 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
4 Q9Y3C1 NOP16 0.82498 ribosome biogenesis GO:0042254
5 Q8N609 TRAM1L1 0.82037 protein targeting GO:0006605
protein transport GO:0015031
transmembrane transport GO:0055085
...
6 P15692 VEGFA 0.79615 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 P09430 TNP1 0.7941 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 P0DPH9 CXorf51B 0.7823
9 P0C843 LINC00032 0.78092
10 P17026 ZNF22 0.7803 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEE
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             ..DDDD.................................................................D.......DDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDD.......................DDDDDDDDDDDDD..............................DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDD.........................................................................DDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................DDDDDDDDDDDDDDDD
RICH_[K]:                                                                                                     KKtramrrrlnKhee
RICH_[R]:                                                                                                   RpkktRamRRRlnkhee
RICH_[KN]:                                                                                                              NKhee
RICH_[KR]:                                                                                                  RpKKtRamRRRlnKhee
RICH_[NR]:                                                                                                          RRRlNkhee
RICH_MOBI_[K]:                                                                                                KKtramrrrlnKhee
RICH_MOBI_[R]:                                                                                                   RamRRRlnkhee
RICH_MOBI_[KN]:                                                                                                         NKhee
RICH_MOBI_[KR]:                                                                                               KKtRamRRRlnKhee
RICH_MOBI_[NR]:                                                                                                     RRRlNkhee

                                          120                 
AA:                      NLKTKKQQRKERLYPLRKYAVKA
STMI:                                           
DO_DISOPRED3:            .......................
DO_IUPRED2A:             DDDDDDDDDD..D..........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDD..........
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                nlKtKKqqrK             
RICH_[R]:                nlktkkqqRkeR           
RICH_[KN]:               NlKtK                  
RICH_[KR]:               nlKtKKqqRKeR           
RICH_[NR]:               N                      
RICH_MOBI_[K]:           nlKtKKqqrKerlyplrKyavK 
RICH_MOBI_[R]:           nlktkkqqRkeR           
RICH_MOBI_[KN]:          NlKtK                  
RICH_MOBI_[KR]:          nlKtKKqqRKeR           
RICH_MOBI_[KY]:            KtKKqqrKerlYplrKYavK 
RICH_MOBI_[NR]:          N                      
RICH_fLPS_MOBI_[K]:        KtKKqqrKerlyplrKyavK