P15692 VEGFA_HUMAN
Gene name: VEGFA
Protein name: Vascular endothelial growth factor A
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell division GO:0051301
- cell junction organization GO:0034330
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- circulatory system process GO:0003013
- developmental maturation GO:0021700
- DNA metabolic process GO:0006259
- embryo development GO:0009790
- growth GO:0040007
- homeostatic process GO:0042592
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6UXX9 | RSPO2 | 0.93764 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 2 | Q13733 | ATP1A4 | 0.89324 | circulatory system process GO:0003013 homeostatic process GO:0042592 reproduction GO:0000003 ... |
| 3 | P55160 | NCKAP1L | 0.85127 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 4 | P09430 | TNP1 | 0.83775 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 5 | Q9NY93 | DDX56 | 0.83077 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q8N609 | TRAM1L1 | 0.82009 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
| 7 | P42766 | RPL35 | 0.79615 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | A0A1B0GUJ8 | PNMA8C | 0.79378 | |
| 9 | Q99848 | EBNA1BP2 | 0.79085 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 10 | Q9H930 | SP140L | 0.7811 |
20 40 60 80 100 AA: MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEES STMI: SSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... DO_IUPRED2A: ............................D....................................................................... DO_SPOTD: ....................DDDDDDDDDDDDDDDDDD.............................................................. CONSENSUS: DDDDDDD................................................................... CONSENSUS_MOBI: DDDDDDDDDD................................................................
120 140 160 180 200 AA: NITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQ STMI: DO_DISOPRED3: .....................................DDDDDDDDDDDDDDDDDDDDDD..D...................................... DO_IUPRED2A: ....DDDDD.............................DDDDDDDDDDDDDDDDD............................................. DO_SPOTD: ..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........ CONSENSUS: .....................................DDDDDDDDDDDDDDDDDDDDDDDDD...................................... CONSENSUS_MOBI: ...................................DDDDDDDDDDDDDDDDDDDDDDDDDD....................................... RICH_[K]: KKsvrgKgKgqKrKrKKsryK RICH_[R]: RqekksvRgkgkgqkRkR RICH_[GK]: KKsvrGKGKGqKrK RICH_[KR]: RqeKKsvRgKgKgqKRKRKKsRyK RICH_fLPS_[K]: KKsvrgKgKgqKrKrKKsryK RICH_MOBI_[K]: KKsvrgKgKgqKrKrKKsryK RICH_MOBI_[R]: RaRqekksvRgkgkgqkRkR RICH_MOBI_[GK]: KKsvrGKGKGqKrK RICH_MOBI_[KR]: RaRqeKKsvRgKgKgqKRKRKKsRyK RICH_fLPS_MOBI_[K]: KKsvrgKgKgqKrKrKKsryK
220 AA: TCKCSCKNTDSRCKARQLELNERTCRCDKPRR STMI: DO_DISOPRED3: ...............................D DO_IUPRED2A: ................................ DO_SPOTD: ..............................DD CONSENSUS: ...............................D CONSENSUS_MOBI: ................................