P0C5Z0 H2AB2_HUMAN
Gene name: H2AB2
Protein name: Histone H2A-Bbd type 2/3
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- mRNA processing GO:0006397
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P52198 | RND2 | 0.89686 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 2 | Q9ULZ1 | APLN | 0.80244 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 3 | P62314 | SNRPD1 | 0.79699 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 4 | Q01081 | U2AF1 | 0.79629 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 nucleocytoplasmic transport GO:0006913 ... |
| 5 | O43323 | DHH | 0.79231 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | Q6IPW1 | C11orf71 | 0.78066 | |
| 7 | Q13724 | MOGS | 0.77733 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 ... |
| 8 | Q9UL41 | PNMA3 | 0.76815 | cell death GO:0008219 |
| 9 | O95985 | TOP3B | 0.75672 | cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 chromosome segregation GO:0007059 ... |
| 10 | Q96D70 | R3HDM4 | 0.75356 |
20 40 60 80 100 AA: MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLST STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDD.......................DD.............................DDD........................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............................................................................... RICH_[R]: RRRRRRgssgaggRgR RICH_[GR]: RRRRRRGssGaGGRGR RICH_fLPS_[R]: mpRRRRRRgssgaggRgRtc RICH_fLPS_[RG]: mpRRRRRRGssGaGGRGR RICH_fLPS_[G]: rGssGaGGrG RICH_MOBI_[R]: RRRRRRgssgaggRgR RICH_MOBI_[GR]: RRRRRRGssGaGGRGR RICH_fLPS_MOBI_[R]: mpRRRRRRgssgaggRgRtc
AA: LFNTTTISQVAPGED STMI: DO_DISOPRED3: .............DD DO_IUPRED2A: ........D..DDDD DO_SPOTD: ..........DDDDD CONSENSUS: ...........DDDD CONSENSUS_MOBI: ...............