Q9ULZ1 APEL_HUMAN

Gene name: APLN
Protein name: Apelin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- circulatory system process GO:0003013
- embryo development GO:0009790
- homeostatic process GO:0042592
- immune system process GO:0002376
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P52198 RND2 0.89597 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
2 Q9UL41 PNMA3 0.87984 cell death GO:0008219
3 Q6IPW1 C11orf71 0.86067
4 O43323 DHH 0.86031 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
5 Q9BXT2 CACNG6 0.83952 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810
6 Q8TCG5 CPT1C 0.82836 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
7 Q86TN4 TRPT1 0.82057 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
8 P0C5Z0 H2AB2 0.80244 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
9 P17152 TMEM11 0.78613 membrane organization GO:0061024
10 Q2TAM9 TUSC1 0.78382

                                           20                  40                  60   
AA:                      MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
STMI:                    SSSSSSSSSSSSSSSSSSSSSS                                                       
DO_DISOPRED3:            D......D......................................DDDDDDDD......................D
DO_IUPRED2A:             ...........................D..DD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                     .....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[G]:                                                              GsrnGpGpwqGG                   
RICH_[R]:                                                       RhlvqpRgsRngpgpwqggRRkfRRqRpR         
RICH_[GR]:                                                      RhlvqpRGsRnGpGpwqGGRRkfRRqRpR         
RICH_fLPS_[R]:                                                        RgsRngpgpwqggRRkfRRqRpR         
RICH_MOBI_[G]:                                                         GsrnGpGpwqGG                   
RICH_MOBI_[R]:                                                        RgsRngpgpwqggRRkfRRqRpR         
RICH_MOBI_[FR]:                                                                    RRkFRRqRpRlshkgpmpF
RICH_MOBI_[GR]:                                                       RGsRnGpGpwqGGRRkfRRqRpR         
RICH_fLPS_MOBI_[R]:                                                   RgsRngpgpwqggRRkfRRqRpR