Q6IPW1 CK071_HUMAN

Gene name: C11orf71
Protein name: Uncharacterized protein C11orf71

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P52198 RND2 0.88321 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
2 Q9ULZ1 APLN 0.86067 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
3 Q9UL41 PNMA3 0.84952 cell death GO:0008219
4 O43323 DHH 0.8338 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
5 A6NL05 FAM74A7 0.82793
6 P17152 TMEM11 0.81899 membrane organization GO:0061024
7 O43541 SMAD6 0.81673 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
8 Q4VXF1 FAM74A3 0.81371
9 Q9BXT2 CACNG6 0.80998 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810
10 O95922 TTLL1 0.80847 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MALNNVSLSSGDQRSRVAYRSSHGDLRPRASALAMVSGDGFLVSRPEAIHLGPRQAVRPSVRAESRRVDGGGRSPREPDGRGRSRQARFSPYPIPAVEPD
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD..DDDDD...................................................DDDDDDDDDDDDDDDDDDDD.................
DO_IUPRED2A:             .DDDDDDD..DDDDDDDDDDDDDD....DD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDD....DD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDD...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........
RICH_[RV]:                                                                    RqaVRpsVRaesRRV                                
RICH_[G]:                                                                                     GGGrsprepdGrG                  
RICH_[R]:                                                                     RqavRpsvRaesRRvdgggRspRepdgRgRsRqaR            
RICH_[S]:                      SlSSgdqrSrvayrSS                                                                              
RICH_[GR]:                                                                            RaesRRvdGGGRspRepdGRGRsRqaR            
RICH_fLPS_[R]:                                                                            RRvdgggRspRepdgRgRsRqaR            
RICH_MOBI_[RV]:                                                               RqaVRpsVRaesRRV                                
RICH_MOBI_[G]:                                                                                GGGrsprepdGrG                  
RICH_MOBI_[R]:                                                                RqavRpsvRaesRRvdgggRspRepdgRgRsRqaR            
RICH_MOBI_[GR]:                                                                       RaesRRvdGGGRspRepdGRGRsRqaR            
RICH_fLPS_MOBI_[R]:                                                                       RRvdgggRspRepdgRgRsR               

                                          120                 
AA:                      LLRSVLQQRLIALGGVIAARISV
STMI:                                           
DO_DISOPRED3:            ......................D
DO_IUPRED2A:             .......................
DO_SPOTD:                ...................DDDD
CONSENSUS:               ......................D
CONSENSUS_MOBI:          .......................