P0C841 FA66E_HUMAN

Gene name: FAM66E
Protein name: Putative protein FAM66E

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q7Z7G0 ABI3BP 0.6642 cell adhesion GO:0007155
extracellular matrix organization GO:0030198
2 Q9UF83 n/a 0.64178
3 Q13477 MADCAM1 0.62952 cell adhesion GO:0007155
extracellular matrix organization GO:0030198
immune system process GO:0002376
...
4 P46695 IER3 0.62209 anatomical structure development GO:0048856
cell death GO:0008219
response to stress GO:0006950
...
5 Q9Y534 CSDC2 0.6046 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
6 I3L273 GFY 0.59729 cellular component assembly GO:0022607
nervous system process GO:0050877
7 Q96LL9 DNAJC30 0.59673 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
8 Q96N19 GPR137 0.59439 catabolic process GO:0009056
homeostatic process GO:0042592
signal transduction GO:0007165
9 Q9NZP6 NPAP1 0.5873 anatomical structure development GO:0048856
cell differentiation GO:0030154
nucleocytoplasmic transport GO:0006913
...
10 A1L4H1 SSC5D 0.58708 anatomical structure development GO:0048856
immune system process GO:0002376
response to stress GO:0006950

                                           20                  40             
AA:                      MLASGAESQDRYRNTPSSRIFTPGFRPTPATTPEPGIYMFNMEPSQP
STMI:                                                                   
DO_DISOPRED3:            DDDDDD.D.....................................DD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDD......DDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PR]:                         RyRntPssRiftPgfRPtP                  
RICH_[PT]:                             TPssrifTPgfrPTPaTTPeP            
RICH_[P]:                               PssriftPgfrPtPattPeP            
RICH_[R]:                          RyRntpssRiftpgfR                     
RICH_[T]:                              TpssrifTpgfrpTpaTT               
RICH_[FP]:                                   FtPgFrPtPattPeP            
RICH_MOBI_[PT]:                         PssrifTPgfrPTPaTTPeP            
RICH_MOBI_[P]:                          PssriftPgfrPtPattPeP            
RICH_MOBI_[R]:                     RyRntpssRiftpgfR                     
RICH_MOBI_[T]:                         TpssrifTpgfrpTpaTT               
RICH_MOBI_[FI]:                             IFtpgFrptpattpepgI          
RICH_MOBI_[FM]:                                  FrptpattpepgiyMFnM     
RICH_MOBI_[FP]:                         PssriFtPgFrPtPattPeP            
RICH_MOBI_[FR]:                    RyRntpssRiFtpgFR                     
RICH_MOBI_[FT]:                        TpssriFTpgFrpTpaTTpepgiymF       
RICH_MOBI_[IT]:                             IfTpgfrpTpaTTpepgI