Q9Y534 CSDC2_HUMAN

Gene name: CSDC2
Protein name: Cold shock domain-containing protein C2

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- nucleobase-containing compound catabolic process GO:0034655

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y2V2 CARHSP1 0.63491 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
nucleobase-containing compound catabolic process GO:0034655
...
2 P0C841 FAM66E 0.6046
3 Q6P5Z2 PKN3 0.60378 cellular protein modification process GO:0006464
signal transduction GO:0007165
4 Q16584 MAP3K11 0.60264 cell cycle GO:0007049
cell death GO:0008219
cellular protein modification process GO:0006464
...
5 P59797 SELENOV 0.59855
6 Q9UQ16 DNM3 0.59832 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
7 Q9NP71 MLXIPL 0.59249 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
8 Q8IUC6 TICAM1 0.5885 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 Q8N9R0 LINC00304 0.58837
10 Q9UMN6 KMT2B 0.57506 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSD
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDD...................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDD....DDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDD.DDDD..........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
RICH_[PR]:                                           RegsRvweRggvPPRdlPsP                                                    
RICH_[PT]:                                                       PPrdlPsPlPTkrTrTysaT                                        
RICH_[PV]:                      PPVVPPlhsPksPVwP                                                                             
RICH_[PW]:                               PksPvWPtfPfhregsrvW                                                                 
RICH_[AT]:                                                                 TkrTrTysATArAsA                                   
RICH_[RT]:                                                         RdlpsplpTkRTRTysaTaR                                      
RICH_[P]:                       PPvvPPlhsPksPvwPtfP              PPrdlPsPlP                                                  
RICH_[R]:                                            RegsRvweRggvppR                                                         
RICH_[T]:                                                                  TkrTrTysaT                                        
RICH_[W]:                                     WptfpfhregsrvW                                                                 
RICH_[FP]:                           PlhsPksPvwPtFPF                                                                         
RICH_[FW]:                                    WptFpFhregsrvW                                                                 
RICH_fLPS_[P]:                 sPPvvPPlhsPksPvwPtfP                                                                          
RICH_MOBI_[PV]:                 PPVVPPlhsPksPVwP                                                                             
RICH_MOBI_[RT]:                                                    RdlpsplpTkRTRTysaTaR                                      
RICH_MOBI_[P]:                  PPvvPPlhsPksPvwPtfP              PPrdlPsPlP                                                  
RICH_MOBI_[R]:                                       RegsRvweRggvppR                                                         
RICH_MOBI_[T]:                                                             TkrTrTysaT                                        
RICH_MOBI_[W]:                                WptfpfhregsrvW                                                                 
RICH_MOBI_[FP]:                 PPvvPPlhsPksPvwPtFPF                                                                         
RICH_MOBI_[FR]:                                  FpFhRegsRvweRggvppR                                                         
RICH_MOBI_[FW]:                               WptFpFhregsrvW                                                                 
RICH_MOBI_[GV]:                                        GsrVwerGGV                                                            

                                          120                 140       
AA:                      IEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS
STMI:                                                                         
DO_DISOPRED3:            ...............................................DDDDDD
DO_IUPRED2A:             ...............D..D...........DD.DD..DD...DDDDDDDDDD.
DO_SPOTD:                ................................................DDDDD
CONSENSUS:               ...............................................DDDDDD
CONSENSUS_MOBI:          .....................................................