P61278 SMS_HUMAN

Gene name: SST
Protein name: Somatostatin

List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H857 NT5DC2 0.89443
2 B1AMM8 LINC00587 0.86378
3 P0C851 PIRT 0.8165 response to stress GO:0006950
signal transduction GO:0007165
transmembrane transport GO:0055085
...
4 Q9UFH2 DNAH17 0.81373 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
5 Q92187 ST8SIA4 0.75593 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
6 Q8NA42 ZNF383 0.74741 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 Q9H892 TTC12 0.69099
8 Q99633 PRPF18 0.6495 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
9 Q69YU5 BRAWNIN 0.64249 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
10 Q96LX8 ZNF597 0.63569 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRE
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSS                                                                            
DO_DISOPRED3:            D.DDDDDDDDDDDDDDDDDDDDDD........................................DDDDDDDDDDDDDDDDDDDDDDDD....DD..D...
DO_IUPRED2A:             .............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                       .....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS_MOBI:                                  .....................................DDDDDDDDDDDDDDDDDDDDD..................
RICH_[EL]:                                                                                  LEpEdLsqaaEqdEmrLEL              

                             
AA:                      RKAGCKNFFWKTFTSC
STMI:                                    
DO_DISOPRED3:            ................
DO_IUPRED2A:             ................
DO_SPOTD:                DDDD............
CONSENSUS:               ................
CONSENSUS_MOBI:          ................