P0C854 CECR9_HUMAN
Gene name: CECR9
Protein name: Putative cat eye syndrome critical region protein 9
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96RS6 | NUDCD1 | 0.70711 | immune system process GO:0002376 |
| 2 | Q9NVS2 | MRPS18A | 0.70711 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 3 | A6NK06 | ACOD1 | 0.64659 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q6UXQ4 | C2orf66 | 0.50484 | |
| 5 | P26715 | KLRC1 | 0.49581 | immune system process GO:0002376 signal transduction GO:0007165 |
| 6 | Q9NXJ0 | MS4A12 | 0.46563 | |
| 7 | O00141 | SGK1 | 0.46507 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 8 | P31994 | FCGR2B | 0.37139 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 9 | P38435 | GGCX | 0.36238 | cellular protein modification process GO:0006464 response to stress GO:0006950 |
| 10 | Q9BQB4 | SOST | 0.36 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MQSHLAPLACAAAAGRAGGSCQAAQPEDRRVLRYPGTAVMVTCPNRPLVPRPLLTPGGSRASLALCAFVAVPQRIPQPLLPAYILLMLPSLVVDMALPSS STMI: SSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: ...........................D.......................D.D.............................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: ............................................................................. CONSENSUS_MOBI: .............................................................................
120 140 160 180 200 AA: RLLRSIKPIQPASQVVRKERNPNPNCPQSDPLMKASSTSFLSHTYLINKTRSTTRKVEEHSWFTCTGAKYFAIPLAERNTKRLTKRSTHAQLLRGKQDGS STMI: DO_DISOPRED3: ........................D........................................................................... DO_IUPRED2A: ............DDDDDDDDDDDDDDDDDDDDD................................................D.DDDDDDDDD..DDDD.. DO_SPOTD: ..................DDDDDDDDDDDDD................................................................DDD.. CONSENSUS: ..................DDDDDDDDDDDDD................................................................DDD.. CONSENSUS_MOBI: .................................................................................................... RICH_[NP]: PNPNcPqsdP
AA: EWVVPRSSASSNVLYH STMI: DO_DISOPRED3: .......DDDDDDDDD DO_IUPRED2A: ..DD..........D. DO_SPOTD: ......DDDDDDDDDD CONSENSUS: .......DDDDDDDDD CONSENSUS_MOBI: ................