Q6UXQ4 CB066_HUMAN

Gene name: C2orf66
Protein name: Uncharacterized protein C2orf66

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y5E5 PCDHB4 0.58898 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
2 P0C854 CECR9 0.50484
3 Q9UN67 PCDHB10 0.43581 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
4 Q9Y5E2 PCDHB7 0.41647 cell adhesion GO:0007155
5 Q9Y5F1 PCDHB12 0.41647 anatomical structure development GO:0048856
cell adhesion GO:0007155
6 Q9Y5F2 PCDHB11 0.37672 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
7 Q9NXJ0 MS4A12 0.3722
8 Q9Y5E9 PCDHB14 0.36249 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
9 Q96RS6 NUDCD1 0.35698 immune system process GO:0002376
10 Q9NVS2 MRPS18A 0.35698 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412

                                           20                  40                  60                  80                 100
AA:                      MIIDSSRIPSFTQLHSTMTRAPLLLLCVALVLLGHVNGATVRNEDKWKPLNNPRNRDLFFRRLQAYFKGRGLDLGTFPNPFPTNENPRPLSFQSELTASA
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                              
DO_DISOPRED3:            DDDDD...............................................................................................
DO_IUPRED2A:             ..........................................DDDDDD.............................DDDD.DDDDDDDD.DD.......
DO_SPOTD:                DDDDDDDDDDD................................................................DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                                     .......................................DDDDDDDDDDDDDDDD.......
CONSENSUS_MOBI:                                                ..............................................................
RICH_[FN]:                                                                                             NpFptNeNprplsF        
RICH_[FP]:                                                                                            PnPFPtnenPrPlsF        
RICH_[NP]:                                                                                            PNPfPtNeNPrP           

                            
AA:                      SADYEEQKNSFHNYLKG
STMI:                                     
DO_DISOPRED3:            ..........DDDDD.D
DO_IUPRED2A:             ..D..............
DO_SPOTD:                DDDDDDDDDDDDDDDDD
CONSENSUS:               ..D.......DDDDDDD
CONSENSUS_MOBI:          .................