Q9NVS2 RT18A_HUMAN
Gene name: MRPS18A
Protein name: 39S ribosomal protein S18a, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NY64 | SLC2A8 | 0.70711 | carbohydrate metabolic process GO:0005975 cell cycle GO:0007049 membrane organization GO:0061024 ... |
| 2 | Q6Q0C1 | SLC25A47 | 0.70711 | transport GO:0006810 |
| 3 | O00141 | SGK1 | 0.70156 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 4 | Q9BZR9 | TRIM8 | 0.66475 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q8N5N4 | C3orf22 | 0.62573 | |
| 6 | O75147 | OBSL1 | 0.61958 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 7 | H3BNL1 | C3orf84 | 0.61812 | |
| 8 | Q9BQI0 | AIF1L | 0.61394 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 9 | Q9UJ71 | CD207 | 0.59274 | immune system process GO:0002376 response to stress GO:0006950 transport GO:0006810 ... |
| 10 | O95140 | MFN2 | 0.58835 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MAALKALVSGCGRLLRGLLAGPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGML STMI: TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... DO_IUPRED2A: .....................................D..D....DDDDDDDDDDDDDDDDDDDDDDDDD.............................. DO_SPOTD: DDDDDDDD..D..DD.DDDDDD.............................DDDDDDDDDDDDDDDD................................. CONSENSUS: .................DDDDDDDDDDDDDDDD................................. CONSENSUS_MOBI: .................................................................. RICH_[P]: PkesPnPPnP RICH_[NP]: PkesPNPPNP
120 140 160 180 AA: PRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH STMI: DO_DISOPRED3: ................................................................................................ DO_IUPRED2A: ...D........................DDDDDDDDDDDDDDD.......D............................................. DO_SPOTD: ...............................DDD.DDD......................................................DDDD CONSENSUS: ...............................DDDDDDD.......................................................... CONSENSUS_MOBI: ................................................................................................