P0DMW5 SIL2B_HUMAN
Gene name: SMIM10L2B
Protein name: Small integral membrane protein 10-like protein 2B
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P17655 | CAPN2 | 0.99996 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 2 | Q9UFG5 | C19orf25 | 0.99996 | |
| 3 | Q9NUP9 | LIN7C | 0.99967 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 protein transport GO:0015031 ... |
| 4 | Q96MZ0 | GDAP1L1 | 0.99967 | |
| 5 | Q96T76 | MMS19 | 0.99967 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9NVX2 | NLE1 | 0.99967 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 7 | Q96B86 | RGMA | 0.99964 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 8 | Q9HCM9 | TRIM39 | 0.99964 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 9 | Q8WWT9 | SLC13A3 | 0.99896 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | Q96S52 | PIGS | 0.99896 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
20 40 60 AA: MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD..DD......................................................... DO_IUPRED2A: .............................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS_MOBI: .............................................................................. RICH_[A]: AAsAAlsAAAAAAAlsglA RICH_fLPS_[A]: mAAsAAlsAAAAAAAlsglA