Q9NUP9 LIN7C_HUMAN
Gene name: LIN7C
Protein name: Protein lin-7 homolog C
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell-cell signaling GO:0007267
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NVX2 | NLE1 | 1 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 2 | Q86Y56 | DNAAF5 | 1 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 |
| 3 | P0DMW5 | SMIM10L2B | 0.99967 | |
| 4 | Q08AG7 | MZT1 | 0.99941 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 5 | Q9UFG5 | C19orf25 | 0.99941 | |
| 6 | Q96FN4 | CPNE2 | 0.99941 | |
| 7 | Q69YW2 | STUM | 0.99862 | |
| 8 | Q9HCM9 | TRIM39 | 0.99862 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 9 | Q96B86 | RGMA | 0.99862 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | Q8WWT9 | SLC13A3 | 0.99746 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 100 AA: MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTE STMI: DO_DISOPRED3: DDDDDD........................................................DDDDDDDDDDDDDDDDDDDD.................. DO_IUPRED2A: ..................................D.................................D...........DD.......DDDDDDD.... DO_SPOTD: DDDDDD..........................................................DDDDDDDDDDDDDDDDDDDDDD.............. CONSENSUS: DDDDDD..........................................................DDDDDDDDDDDDDDDDDD.................. CONSENSUS_MOBI: .................................................................................................... RICH_[A]: AnAtAkAtvAA RICH_fLPS_[A]: AnAtAkAtvAA
120 140 160 180 AA: EGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT STMI: DO_DISOPRED3: .....................................................................................DDDDDDDDDDDD DO_IUPRED2A: ....DDD..........................D..........DD.......D...........................D.DDDDDDDDDDDDDD DO_SPOTD: .....................................................................................DDDDDDDDDDDD CONSENSUS: .....................................................................................DDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................