Q9UFG5 CS025_HUMAN

Gene name: C19orf25
Protein name: UPF0449 protein C19orf25

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UFG5 C19orf25 1
2 P0DMW5 SMIM10L2B 0.99996
3 Q9HCM9 TRIM39 0.99984 catabolic process GO:0009056
cell cycle GO:0007049
cell death GO:0008219
...
4 Q96B86 RGMA 0.99984 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
5 Q69YW2 STUM 0.99984
6 Q96MZ0 GDAP1L1 0.99941
7 Q9NUP9 LIN7C 0.99941 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
protein transport GO:0015031
...
8 Q99471 PFDN5 0.99941 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell-cell signaling GO:0007267
...
9 Q9NVX2 NLE1 0.99941 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
10 Q8WWT9 SLC13A3 0.99932 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810

                                           20                  40                  60                  80                 100
AA:                      MGSKAKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTILAPEDPPVPFRMMEDAEAPGEQLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLERE
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD......................................DDDDDDDDDDD.............................................
DO_IUPRED2A:             ...DDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D.....................D...DDDDD.D
DO_SPOTD:                DDDDDDDDDD..................................DDDDDDDDDDDDD..........................................D
CONSENSUS:               DDDDDDDDDD..................................DDDDDDDDDDDDD..........................................D
CONSENSUS_MOBI:          ....................................................................................................

                           
AA:                      VAQMKQAALPAAEAASSG
STMI:                                      
DO_DISOPRED3:            ........DDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..................
RICH_[A]:                 AqmkqAAlpAAeAA   
RICH_fLPS_[A]:           vAqmkqAAlpAAeAA