Q9Y5I7 CLD16_HUMAN
Gene name: CLDN16
Protein name: Claudin-16
List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- cell junction organization GO:0034330
- cellular component assembly GO:0022607
- homeostatic process GO:0042592
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BWF3 | RBM4 | 0.76471 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q9BQ04 | RBM4B | 0.76317 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 3 | Q9NR97 | TLR8 | 0.71825 | cellular protein modification process GO:0006464 immune system process GO:0002376 response to stress GO:0006950 ... |
| 4 | P54762 | EPHB1 | 0.71512 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 5 | P10747 | CD28 | 0.68118 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 6 | Q9UIB8 | CD84 | 0.67641 | catabolic process GO:0009056 cell adhesion GO:0007155 immune system process GO:0002376 ... |
| 7 | Q9Y262 | EIF3L | 0.63552 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 8 | P52597 | HNRNPF | 0.61586 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
| 9 | Q9Y5T4 | DNAJC15 | 0.6132 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein targeting GO:0006605 ... |
| 10 | P55771 | PAX9 | 0.60857 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRDLLQYIACFFAFFSAGFLIVATWTDCWM STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDD........................DD.DDDDD.DDDDDDDDDDDDDDDD.............................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD.....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................... CONSENSUS: DDD..........................DDDDDDDDDDDDDDDDDDDDDDDDD................... ...... CONSENSUS_MOBI: ......................................................................... ......
120 140 160 180 200 AA: VNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVAGATLLIAGTP STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................. .............. CONSENSUS_MOBI: .................................................. ..............
220 240 260 280 300 AA: GIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYA STMI: MMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: .............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D CONSENSUS: ................................. .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................. ........................................ RICH_[AY]: YpYslrkAYsAAgvsmAksYsAprtetA RICH_[A]: AysAAgvsmAksysA RICH_[Y]: YpYslrkaYsaagvsmaksY RICH_fLPS_[Y]: vgpernYpYslrkaYsaagvsmaksY
AA: VDTRV STMI: DO_DISOPRED3: DDDDD DO_IUPRED2A: ..... DO_SPOTD: DDDDD CONSENSUS: DDDDD CONSENSUS_MOBI: .....