P10966 CD8B_HUMAN
Gene name: CD8B
Protein name: T-cell surface glycoprotein CD8 beta chain
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- immune system process GO:0002376
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O15144 | ARPC2 | 0.9015 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 2 | Q16695 | H3-4 | 0.87564 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 3 | Q8N0W5 | IQCK | 0.83999 | |
| 4 | Q9ULV4 | CORO1C | 0.83579 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | P84243 | H3-3A | 0.79074 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 6 | Q9NV72 | ZNF701 | 0.76993 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q9Y3N9 | OR2W1 | 0.75698 | |
| 8 | Q9Y6A9 | SPCS1 | 0.75698 | biological process involved in symbiotic interaction GO:0044403 cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 ... |
| 9 | Q9H267 | VPS33B | 0.75698 | cellular protein modification process GO:0006464 membrane organization GO:0061024 protein transport GO:0015031 ... |
| 10 | Q9H0A6 | RNF32 | 0.74945 |
20 40 60 80 100 AA: MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI STMI: SSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: .D.D.DDDDDDDDDD..................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ............................................................................... CONSENSUS_MOBI: ...............................................................................
120 140 160 180 200 AA: LNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRA STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD................................... DO_IUPRED2A: ....................................................DDDD............................................ DO_SPOTD: ......................................DDDDDDDDDDDDDDDDDDDDDDDDDDD...............................DDDD CONSENSUS: ......................................DDDDDDDDDDDDDDDDDDDDDDDDDDD..... ......... CONSENSUS_MOBI: ...................................................................... ......... RICH_[K]: KKstlKKrvcrlprpetqK RICH_[T]: TTaqpTkksT RICH_[KT]: TTaqpTKKsTlKK
AA: RLRFMKQFYK STMI: DO_DISOPRED3: ........DD DO_IUPRED2A: .......... DO_SPOTD: DDDDDDDDDD CONSENSUS: ........DD CONSENSUS_MOBI: ..........