Q16695 H31T_HUMAN
Gene name: H3-4
Protein name: Histone H3.1t
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P84243 | H3-3A | 0.94256 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 2 | Q71DI3 | H3C15 | 0.9045 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 3 | P10966 | CD8B | 0.87564 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 signal transduction GO:0007165 |
| 4 | Q8N0W5 | IQCK | 0.74944 | |
| 5 | O15144 | ARPC2 | 0.74651 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 6 | Q6NXT2 | H3-5 | 0.73682 | growth GO:0040007 |
| 7 | Q9ULV4 | CORO1C | 0.7357 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 8 | Q5VTE0 | EEF1A1P5 | 0.73439 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 9 | Q8NI60 | COQ8A | 0.71022 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 10 | Q9NXB9 | ELOVL2 | 0.69453 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESY STMI: DO_DISOPRED3: D...............DDDDDDDDDDDDDD.D.................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD..DDD................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS_MOBI: D................DDDDDDDD....D...................................................................... RICH_[AK]: ArKstggKAprKqlAtKvA RICH_[K]: KqtarKstggKaprKqlatKvarK RICH_[T]: TkqTarksTggkaprkqlaT RICH_[KT]: TKqTarKsTggKaprKqlaT
120 AA: LVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA STMI: DO_DISOPRED3: ...................................D DO_IUPRED2A: .................................... DO_SPOTD: .................................DDD CONSENSUS: ...................................D CONSENSUS_MOBI: ....................................