P84243 H33_HUMAN
Gene name: H3-3A
Protein name: Histone H3.3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- growth GO:0040007
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q71DI3 | H3C15 | 0.97346 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 2 | Q16695 | H3-4 | 0.94256 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 3 | P10966 | CD8B | 0.79074 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 signal transduction GO:0007165 |
| 4 | Q96DX8 | RTP4 | 0.73476 | immune system process GO:0002376 membrane organization GO:0061024 nervous system process GO:0050877 ... |
| 5 | Q5VTE0 | EEF1A1P5 | 0.71603 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 6 | Q5TEC6 | H3-2 | 0.71331 | |
| 7 | Q8NI60 | COQ8A | 0.7107 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 8 | Q6NXT2 | H3-5 | 0.69687 | growth GO:0040007 |
| 9 | Q9NXB9 | ELOVL2 | 0.68245 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 10 | Q8N0W5 | IQCK | 0.67678 |
20 40 60 80 100 AA: MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAY STMI: DO_DISOPRED3: D...............DDDDDDDDDDDDDDD..................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS_MOBI: D...........................D....................................................................... RICH_[AK]: ArKstggKAprKqlAtKAArKsA RICH_[A]: AprkqlAtkAArksA RICH_[K]: KqtarKstggKaprKqlatKaarK RICH_[T]: TkqTarksTggkaprkqlaT RICH_[KT]: TKqTarKsTggKaprKqlaT
120 AA: LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA STMI: DO_DISOPRED3: ...................................D DO_IUPRED2A: .................................... DO_SPOTD: .................................DDD CONSENSUS: ...................................D CONSENSUS_MOBI: ....................................