P12872 MOTI_HUMAN

Gene name: MLN
Protein name: Promotilin [Cleaved into: Motilin; Motilin-associated peptide

List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5T3U5 ABCC10 0.94711 transmembrane transport GO:0055085
transport GO:0006810
2 O43868 SLC28A2 0.91937 cellular nitrogen compound metabolic process GO:0034641
circulatory system process GO:0003013
homeostatic process GO:0042592
...
3 Q9UL42 PNMA2 0.90386 cell death GO:0008219
4 Q9UJA5 TRMT6 0.90339 cellular nitrogen compound metabolic process GO:0034641
5 P13727 PRG2 0.87575 immune system process GO:0002376
response to stress GO:0006950
transport GO:0006810
...
6 A6NMX2 EIF4E1B 0.8623
7 Q6I9Y2 THOC7 0.85913 biological process involved in symbiotic interaction GO:0044403
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
8 Q96PH6 DEFB118 0.85667 cell adhesion GO:0007155
immune system process GO:0002376
reproduction GO:0000003
...
9 Q8NCJ5 SPRYD3 0.85639 cytoskeleton organization GO:0007010
signal transduction GO:0007165
10 P51858 HDGF 0.85507 biosynthetic process GO:0009058
cell division GO:0051301
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPAT
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSS                                                                           
DO_DISOPRED3:            DDDDDDDDDDD...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
DO_IUPRED2A:             .....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DD...................
DO_SPOTD:                DDDDDDDDDDDDD........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
CONSENSUS:                                        ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
CONSENSUS_MOBI:                                   ......................DDDDDDDDDDDDDDDDDDDDDDDDD............................
RICH_[E]:                                                                          EEgpvdpaEpirEEE                           
RICH_fLPS_[E]:                                                                     EEgpvdpaEpirEEE                           
RICH_MOBI_[E]:                                                                     EEgpvdpaEpirEE                            

                              
AA:                      LEGLLSEMLPQHAAK
STMI:                                   
DO_DISOPRED3:            ............DDD
DO_IUPRED2A:             ..............D
DO_SPOTD:                ..........DDDDD
CONSENSUS:               ............DDD
CONSENSUS_MOBI:          ...............