P13984 T2FB_HUMAN
Gene name: GTF2F2
Protein name: General transcription factor IIF subunit 2
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P16885 | PLCG2 | 0.74278 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | Q5BJF2 | TMEM97 | 0.70711 | growth GO:0040007 homeostatic process GO:0042592 |
| 3 | P15622 | ZNF250 | 0.67814 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | Q86UL3 | GPAT4 | 0.65815 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 5 | Q9NYT0 | PLEK2 | 0.63636 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 6 | Q8N141 | ZFP82 | 0.62471 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q6DWJ6 | GPR139 | 0.51632 | signal transduction GO:0007165 |
| 8 | Q9ULW2 | FZD10 | 0.50738 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 9 | P62241 | RPS8 | 0.43771 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | Q7RTY1 | SLC16A9 | 0.4353 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: D.DDDDDD.................................DDDD.......................DDDDDD.DD.DDDD.................. DO_SPOTD: DDDDDDDDDDDDD....................................................................................... CONSENSUS: DDDDDDDD............................................................................................ CONSENSUS_MOBI: D...................................................................................................
120 140 160 180 200 AA: SDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLK STMI: DO_DISOPRED3: ........................................................DDDDDDDDDDDDDDDDD........................... DO_IUPRED2A: ...........................D...............................DDD.DDDDDDDDDDDDDD....................... DO_SPOTD: ...............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................... CONSENSUS: ........................................................DDDDDDDDDDDDDDDDDDDDD....................... CONSENSUS_MOBI: .................................................................................................... RICH_[KY]: YnieYerKKKedgK
220 240 AA: DLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD STMI: DO_DISOPRED3: ........................................DDDDDDDDD DO_IUPRED2A: ......................................DDD..DDDDDD DO_SPOTD: .........................................DDDDDDDD CONSENSUS: ........................................DDDDDDDDD CONSENSUS_MOBI: ...........................................DDDDDD