Q5BJF2 SGMR2_HUMAN
Gene name: TMEM97
Protein name: Sigma intracellular receptor 2
List of terms from Generic GO subset, which this protein is a part of:
- growth GO:0040007
- homeostatic process GO:0042592
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q00013 | MPP1 | 0.80607 | immune system process GO:0002376 signal transduction GO:0007165 |
| 2 | P14222 | PRF1 | 0.70711 | cell death GO:0008219 cellular component assembly GO:0022607 immune system process GO:0002376 ... |
| 3 | Q9P1P4 | TAAR3P | 0.70711 | nervous system process GO:0050877 |
| 4 | Q9UK45 | LSM7 | 0.65271 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 5 | P62834 | RAP1A | 0.58835 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | O95347 | SMC2 | 0.57928 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 7 | P60002 | ELOF1 | 0.57021 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 8 | Q00059 | TFAM | 0.55216 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q14CX7 | NAA25 | 0.55216 | cellular protein modification process GO:0006464 protein maturation GO:0051604 |
| 10 | Q13609 | DNASE1L3 | 0.53435 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
20 40 60 80 100 AA: MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPA STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM M DO_DISOPRED3: DDDDDD.D............................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDD.............................................................................................. CONSENSUS: DDDDDD... ...................................... .......... CONSENSUS_MOBI: ......... ...................................... ..........
120 140 160 AA: IIYSVHTMTTLIPILSTFLFEDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK STMI: MMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..................................................................DDDDDDDDDD DO_IUPRED2A: ............................................................................ DO_SPOTD: ...............................................................DDDDDDDDDDDDD CONSENSUS: .................... .....DDDDDDDDDD CONSENSUS_MOBI: .................... ............... RICH_[KY]: YKYeeKrKKK RICH_fLPS_[K]: yKyeeKrKKK