P16949 STMN1_HUMAN

Gene name: STMN1
Protein name: Stathmin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell division GO:0051301
- cell morphogenesis GO:0000902
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- homeostatic process GO:0042592
- mitotic cell cycle GO:0000278
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q7Z4B0 LINC00305 0.86932
2 A8MZ26 EFCAB9 0.85337 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
3 Q9NYU2 UGGT1 0.8387 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
4 Q96EA4 SPDL1 0.82225 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
5 A6NCM1 IQCA1L 0.82022
6 Q14512 FGFBP1 0.81182 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell population proliferation GO:0008283
...
7 P19087 GNAT2 0.80766 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
8 P53985 SLC16A1 0.80647 cell cycle GO:0007049
cell-cell signaling GO:0007267
circulatory system process GO:0003013
...
9 O43148 RNMT 0.79783 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
10 Q6Q759 SPAG17 0.79235 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
transport GO:0006810

                                           20                  40                  60                  80                 100
AA:                      MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDD..................DDDDDDDDDDDDDD.........................................................
DO_IUPRED2A:             .DDDDDDDDDD.......DDDDDD.D...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDD....D........................................................................................
CONSENSUS:               DDDDDDDDDDD..................DDDDDDDDDDDDDD.........................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[AE]:                                                                EAAEErrkshEAEvlkqlAE                        Ek
RICH_MOBI_[AK]:                                                                                                             K
RICH_MOBI_[E]:                                                          EEiqkklEaaEErrkshEaEvlkqlaEkrEhEkEvlqkaiEE           
RICH_MOBI_[K]:                                       KesvpefplsppKKKdlsleeiqKKleaaeerrKsheaevlK              KaieennnfsKmaeeK
RICH_MOBI_[L]:                                               LsppkkkdLsLeeiqkkL                                              
RICH_MOBI_[M]:                                                                                                          Maeek
RICH_MOBI_[N]:                                                                                                    NNNfskmaeek
RICH_MOBI_[EK]:                                                  KKKdlslEEiqKKlEaaEErrK    EvlKqlaEKrEhEKEvlqKaiEE     KmaEEK
RICH_MOBI_[EL]:                                                      LsLEEiqkkLEaaEE                                         
RICH_MOBI_[EM]:                                                                                                 EEnnnfskMaEEk
RICH_MOBI_[EN]:                                                                                                  ENNNfskmaEEk
RICH_MOBI_[KL]:                                              LsppKKKdLsLeeiqKKL                                              
RICH_MOBI_[KM]:                                                                                                        KMaeeK
RICH_MOBI_[KN]:                                                                                                   NNNfsKmaeeK
RICH_MOBI_[MN]:                                                                                                   NNNfskMaeek

                                          120                 140           
AA:                      LTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
STMI:                                                                     
DO_DISOPRED3:            ......................................DDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ......................D..DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ......................DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                                         KdKhieevrKnKesK         
RICH_[EK]:                                       EKdKhiEEvrKnKEsKdpadEtE  
RICH_MOBI_[AE]:          lthkmEAnkEnrEAqmAA                               
RICH_MOBI_[AK]:          lthKmeAnKenreAqmAAK                              
RICH_MOBI_[AM]:              MeAnkenreAqMAA                               
RICH_MOBI_[K]:           lthK    KenreaqmaaKlerlreKdKhieevrKnKesK         
RICH_MOBI_[M]:           lthkM                                            
RICH_MOBI_[N]:           lthkmeaN                                         
RICH_MOBI_[EK]:          lthKmEanKEnrE     KlErlrEKdKhiEEvrKnKEsKdpadEtE  
RICH_MOBI_[EM]:          lthkME                                           
RICH_MOBI_[EN]:          lthkmEaN                                         
RICH_MOBI_[KM]:          lthKMeanK                                        
RICH_MOBI_[KN]:          lthKmeaNK                                        
RICH_MOBI_[MN]:          lthkMeaN