P17152 TMM11_HUMAN
Gene name: TMEM11
Protein name: Transmembrane protein 11, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- membrane organization GO:0061024
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q86V71 | ZNF429 | 0.96702 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | P28062 | PSMB8 | 0.87525 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 3 | O95922 | TTLL1 | 0.87504 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 4 | O75462 | CRLF1 | 0.86199 | anatomical structure development GO:0048856 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 5 | A8MQB3 | LINC02693 | 0.84656 | |
| 6 | Q8WVX3 | C4orf3 | 0.84572 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | Q2TAM9 | TUSC1 | 0.83175 | |
| 8 | Q86X59 | LINC02875 | 0.83114 | |
| 9 | Q69YL0 | NCBP2AS2 | 0.82662 | |
| 10 | O43541 | SMAD6 | 0.82463 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALP STMI: MMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDD.............................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD............................................................... RICH_[G]: GrrrlGpGssGG RICH_[R]: RRRlgpgssggsaReR RICH_[GR]: GRRRlGpGssGGsaReR RICH_MOBI_[G]: GrrrlGpGssGG RICH_MOBI_[R]: RRRlgpgssggsaR RICH_MOBI_[GR]: GRRRlGpGssGGsaR
120 140 160 180 AA: LDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV STMI: MMMMMMMMMMMMMMMMMM DO_DISOPRED3: ............................................................................................ DO_IUPRED2A: ............................................................................................ DO_SPOTD: ............................................................................................ CONSENSUS: ...... .................................................................... CONSENSUS_MOBI: ...... ....................................................................