P18124 RL7_HUMAN
Gene name: RPL7
Protein name: 60S ribosomal protein L7
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- ribosome biogenesis GO:0042254
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y2G0 | EFR3B | 0.67139 | |
| 2 | Q9HCX3 | ZNF304 | 0.65621 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | Q8NI36 | WDR36 | 0.65008 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 4 | Q9H813 | PACC1 | 0.63327 | transport GO:0006810 |
| 5 | P48065 | SLC6A12 | 0.56349 | transport GO:0006810 |
| 6 | Q9HC73 | CRLF2 | 0.53852 | cell population proliferation GO:0008283 immune system process GO:0002376 signal transduction GO:0007165 |
| 7 | Q9UNK0 | STX8 | 0.53852 | immune system process GO:0002376 membrane organization GO:0061024 protein transport GO:0015031 ... |
| 8 | Q9BWM5 | ZNF416 | 0.53247 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | A6NHS1 | n/a | 0.50314 | |
| 10 | Q9UN42 | ATP1B4 | 0.48876 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGING STMI: DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: .D.........DDDDDD................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDD................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDD...................................................................................... RICH_[E]: EgvEEkkkEvpavpE RICH_[EV]: EgVEEkkkEVpaVpE RICH_MOBI_[EV]: EgVEEkkkEV RICH_MOBI_[KV]: VeeKKKeVpaV
120 140 160 180 200 AA: VSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKR STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: FKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN STMI: DO_DISOPRED3: ................................................ DO_IUPRED2A: .......................DDDDDD.DD................ DO_SPOTD: ................................................ CONSENSUS: ................................................ CONSENSUS_MOBI: ................................................