A6NHS1 YK042_HUMAN

Protein name: Putative uncharacterized protein ENSP00000347057

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UJG1 MOSPD1 0.6647 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
2 P55064 AQP5 0.66066 anatomical structure development GO:0048856
cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
...
3 Q9UKJ5 CHIC2 0.66066
4 Q96RQ3 MCCC1 0.66066 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
5 Q9UI26 IPO11 0.66027 nucleocytoplasmic transport GO:0006913
protein transport GO:0015031
transport GO:0006810
6 P42857 NSG1 0.65898 cell death GO:0008219
cell-cell signaling GO:0007267
cellular component assembly GO:0022607
...
7 Q07817 BCL2L1 0.65662 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
...
8 Q86XI2 NCAPG2 0.65402 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
9 Q9BTA0 FAM167B 0.64783
10 Q13049 TRIM32 0.64783 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80      
AA:                      MVLLAGTRPQGGEARCMIPPPPSPLLGAQVEEDRTEFKEFQDFSSLPDTRSVASDDSLYPFQDEEEHGVEGVESVPEEGILEAWGSCGRWCGVG
STMI:                                                                                                                  
DO_DISOPRED3:            DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDDDDDD................
DO_IUPRED2A:             .DDDD.....DDDDDDDDDDDDDDDDDDDDDD....DDDDDDD.DDDD.....DDDDDDDDDDDDDDDDDDDDDDD..................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........DDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDD................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDD.......................................................................
RICH_[E]:                                                                               EEEhgvEgvEsvpEE                
RICH_[P]:                        PqggearcmiPPPPsP                                                                      
RICH_[EV]:                                                                              EEEhgVEgVEsVpEE                
RICH_fLPS_[E]:                                                                          EEEhgvEgvEsvpEE                
RICH_fLPS_[F]:                                               FkeFqdFssl