P20618 PSB1_HUMAN
Gene name: PSMB1
Protein name: Proteasome subunit beta type-1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- nucleobase-containing compound catabolic process GO:0034655
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8TBJ5 | FEZF2 | 0.86107 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 2 | P38919 | EIF4A3 | 0.62761 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 3 | P25098 | GRK2 | 0.61661 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell-cell signaling GO:0007267 ... |
| 4 | Q96HR3 | MED30 | 0.5709 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q9BXG8 | SPZ1 | 0.56133 | |
| 6 | Q9ULK4 | MED23 | 0.55513 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | P48067 | SLC6A9 | 0.53296 | cell-cell signaling GO:0007267 circulatory system process GO:0003013 transport GO:0006810 |
| 8 | Q8NCU1 | CCDC197 | 0.47782 | |
| 9 | Q17RB8 | LONRF1 | 0.47754 | cellular protein modification process GO:0006464 |
| 10 | O60547 | GMDS | 0.46314 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 ... |
20 40 60 80 100 AA: MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ DO_IUPRED2A: ..................D................................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ RICH_MOBI_[AM]: AMysApgrdlgMephrAA
120 140 160 180 200 AA: KMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAM STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: RLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD STMI: DO_DISOPRED3: .......................................DD DO_IUPRED2A: ....................................D.... DO_SPOTD: .....................................DDDD CONSENSUS: .......................................DD CONSENSUS_MOBI: .........................................