P21730 C5AR1_HUMAN
Gene name: C5AR1
Protein name: C5a anaphylatoxin chemotactic receptor 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- homeostatic process GO:0042592
- immune system process GO:0002376
- nervous system process GO:0050877
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9P296 | C5AR2 | 0.77988 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 homeostatic process GO:0042592 ... |
| 2 | P14543 | NID1 | 0.73882 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell-cell signaling GO:0007267 ... |
| 3 | P32121 | ARRB2 | 0.69345 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | P51790 | CLCN3 | 0.66818 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | O00767 | SCD | 0.6482 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 homeostatic process GO:0042592 ... |
| 6 | Q9UKA2 | FBXL4 | 0.64468 | catabolic process GO:0009056 cellular protein modification process GO:0006464 |
| 7 | Q13530 | SERINC3 | 0.60183 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 8 | Q9Y6J8 | STYXL1 | 0.56482 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 9 | P62495 | ETF1 | 0.56448 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q9BXN2 | CLEC7A | 0.56275 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
20 40 60 80 100 AA: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHH STMI: MMMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...... ..... ....... CONSENSUS_MOBI: ..................................... ..... ....... RICH_[D]: DsfnyttpDyghyDDkDtlDlntpvD RICH_[T]: TTpdyghyddkdTldlnT RICH_[TY]: YTTpdYghYddkdTldlnT RICH_[DT]: TTpDyghyDDkDTlDlnT RICH_[DY]: DsfnYttpDYghYDDkDtlDlntpvD RICH_fLPS_[D]: DsfnyttpDyghyDDkDtlDlntpvD RICH_fLPS_[DY]: DsfnYttpDYghYDDkDtlD RICH_fLPS_[Y]: mdsfnYttpdYghYd
120 140 160 180 200 AA: HWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRER STMI: MMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .......... ..................... .......................... CONSENSUS_MOBI: .......... ..................... ..........................
220 240 260 280 300 AA: AVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY STMI: MMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ................ ................. CONSENSUS_MOBI: ................ .................
320 340 AA: VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV STMI: MMM DO_DISOPRED3: ...........................DDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................................. DO_SPOTD: .........................DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ........................DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .....DDD....................DD................. RICH_[T]: TrsTvdTmaqkT