Q9P296 C5AR2_HUMAN
Gene name: C5AR2
Protein name: C5a anaphylatoxin chemotactic receptor 2
List of terms from Generic GO subset, which this protein is a part of:
- cell population proliferation GO:0008283
- cellular protein modification process GO:0006464
- homeostatic process GO:0042592
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P21730 | C5AR1 | 0.77988 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 2 | Q70EL3 | USP50 | 0.76692 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 3 | Q9BXN2 | CLEC7A | 0.74272 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 4 | A6NDL7 | METTL21EP | 0.74198 | cellular protein modification process GO:0006464 |
| 5 | P0C0L5 | C4B | 0.67289 | immune system process GO:0002376 response to stress GO:0006950 transport GO:0006810 ... |
| 6 | P51636 | CAV2 | 0.65318 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 ... |
| 7 | P30876 | POLR2B | 0.64871 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q9Y6J8 | STYXL1 | 0.62685 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 9 | Q8N485 | LIX1 | 0.62685 | catabolic process GO:0009056 |
| 10 | P62495 | ETF1 | 0.62239 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MGNDSVSYEYGDYSDLSDRPVDCLDGACLAIDPLRVAPLPLYAAIFLVGVPGNAMVAWVAGKVARRRVGATWLLHLAVADLLCCLSLPILAVPIARGGHW STMI: MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDD........... ........... ..... CONSENSUS_MOBI: ...................................... ........... ..... RICH_[D]: DsvsyeygDysDlsDrpvDclD RICH_[DY]: DsvsYeYgDYsDlsDrpvDclD RICH_fLPS_[D]: gDysDlsDrpvDclD RICH_fLPS_[DY]: YeYgDYsDlsDrpvDclD RICH_fLPS_[Y]: mgndsvsYeYgdYsd
120 140 160 180 200 AA: PYGAVGCRALPSIILLTMYASVLLLAALSADLCFLALGPAWWSTVQRACGVQVACGAAWTLALLLTVPSAIYRRLHQEHFPARLQCVVDYGGSSSTENAV STMI: MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .............. ............ ............................ CONSENSUS_MOBI: .............. ............ ............................
220 240 260 280 300 AA: TAIRFLFGFLGPLVAVASCHSALLCWAARRCRPLGTAIVVGFFVCWAPYHLLGLVLTVAAPNSALLARALRAEPLIVGLALAHSCLNPMLFLYFGRAQLR STMI: MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .. ............ .............. ...... CONSENSUS_MOBI: .. ............ .............. ......
320 AA: RSLPAACHWALRESQGQDESVDSKKSTSHDLVSEMEV STMI: DO_DISOPRED3: ..............DDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...................DDDDDDD........... DO_SPOTD: ............DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..............DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .....................................