P24534 EF1B_HUMAN
Gene name: EEF1B2
Protein name: Elongation factor 1-beta
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96ET8 | TVP23C | 0.96125 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 2 | Q9NYZ1 | TVP23B | 0.95578 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 3 | Q8IY51 | TIGD4 | 0.94165 | |
| 4 | Q96K17 | BTF3L4 | 0.9092 | |
| 5 | O14787 | TNPO2 | 0.90605 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 6 | O14958 | CASQ2 | 0.89433 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 7 | O95373 | IPO7 | 0.89201 | biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 cellular protein modification process GO:0006464 ... |
| 8 | Q53HC9 | EIPR1 | 0.88331 | cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 protein transport GO:0015031 ... |
| 9 | A1XBS5 | FAM92A | 0.86816 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 membrane organization GO:0061024 ... |
| 10 | O43520 | ATP8B1 | 0.84886 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDD STMI: DO_DISOPRED3: D.....................................................................DDDDDDDD.D.....DDDDDDDDDDDDDDD DO_IUPRED2A: ...................................D.DD........................................DD.DDDDDDDDDDDDDDDDDD DO_SPOTD: DD.D...............................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: D.....................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: D.......................................................................................DDDDDDDDDDDD RICH_[D]: DveDttgsgatDskDDDD RICH_[DE]: DskDDDD RICH_[GK]: GvKKalGKyG RICH_fLPS_[D]: DveDttgsgatDskDDDD RICH_MOBI_[D]: DskDDDD RICH_MOBI_[DE]: DskDDDD RICH_fLPS_MOBI_[D]: gsgatDskDDDD
120 140 160 180 200 AA: IDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGT STMI: DO_DISOPRED3: DDDDDDDDDD..................DDDDDDDDDD.............................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDD.......DDDDDDDD................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDD..................................................................................... RICH_[D]: iDlfgsDD RICH_[E]: EEEsEEakrlrEE RICH_[DE]: iDlfgsDDEEEsEE RICH_fLPS_[D]: iDlfgsDD RICH_fLPS_[E]: gsddEEEsEE RICH_MOBI_[D]: iDlfgsDD RICH_MOBI_[DE]: iDlfgsDDEEEsEE RICH_fLPS_MOBI_[D]: iDlfgsDD
220 AA: DMLEEQITAFEDYVQSMDVAAFNKI STMI: DO_DISOPRED3: ......................... DO_IUPRED2A: ......................... DO_SPOTD: ......................... CONSENSUS: ......................... CONSENSUS_MOBI: .........................