Q96K17 BT3L4_HUMAN

Gene name: BTF3L4
Protein name: Transcription factor BTF3 homolog 4

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96ET8 TVP23C 0.93849 protein transport GO:0015031
transport GO:0006810
vesicle-mediated transport GO:0016192
2 Q9NYZ1 TVP23B 0.93115 protein transport GO:0015031
transport GO:0006810
vesicle-mediated transport GO:0016192
3 Q8IY51 TIGD4 0.92066
4 P24534 EEF1B2 0.9092 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
5 O14958 CASQ2 0.88678 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
6 O43520 ATP8B1 0.86249 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 O14787 TNPO2 0.85862 nucleocytoplasmic transport GO:0006913
protein transport GO:0015031
transport GO:0006810
8 Q53HC9 EIPR1 0.85254 cell-cell signaling GO:0007267
cellular protein modification process GO:0006464
protein transport GO:0015031
...
9 O95373 IPO7 0.82235 biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
cellular protein modification process GO:0006464
...
10 Q8NAP8 ZBTB8B 0.80904 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPG
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             .D.................DDDDDDDDDDDDDDDD...DD........................D.....DD.......DD.......DD.....D....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
CONSENSUS:               .D.................DDDDDDDDDDDDDDD..................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140  
AA:                      ILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN
STMI:                                                                              
DO_DISOPRED3:            ........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ......DDD............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                         DskapkpeDiDeeDDDvpDlvenfD        
RICH_[DE]:                                               EDiDEEDDDvpDlvEnfDEasknE  
RICH_[EN]:                                                             ENfdEaskNE  
RICH_fLPS_[D]:                                    DskapkpeDiDeeDDDvpDlvenfD        
RICH_MOBI_[D]:                                    DskapkpeDiDeeDDDvpDlvenfD        
RICH_MOBI_[N]:                                                          NfdeaskNeaN
RICH_MOBI_[DE]:                                          EDiDEEDDDvpDlvEnfDEasknE  
RICH_MOBI_[DV]:                                                DDDVpDlVenfD        
RICH_fLPS_MOBI_[D]:                               DskapkpeDiDeeDDDvpDlvenfD