Q9NYZ1 TV23B_HUMAN
Gene name: TVP23B
Protein name: Golgi apparatus membrane protein TVP23 homolog B
List of terms from Generic GO subset, which this protein is a part of:
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q96ET8 | TVP23C | 0.99646 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
2 | Q8IY51 | TIGD4 | 0.97806 | |
3 | P24534 | EEF1B2 | 0.95578 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
4 | Q96K17 | BTF3L4 | 0.93115 | |
5 | Q53HC9 | EIPR1 | 0.90268 | cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 protein transport GO:0015031 ... |
6 | O14958 | CASQ2 | 0.88648 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
7 | O43520 | ATP8B1 | 0.88634 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
8 | O14787 | TNPO2 | 0.87944 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
9 | O95373 | IPO7 | 0.86213 | biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 cellular protein modification process GO:0006464 ... |
10 | A1XBS5 | FAM92A | 0.85759 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 membrane organization GO:0061024 ... |
20 40 60 80 100 AA: MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVYLLCGLLSSSFITCMVTIILLLSCDFWAVKNVTGRLMVGLRWWNHIDEDG STMI: MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... DO_IUPRED2A: DD..........DD.DDD........D......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD... ............................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............ ............................ RICH_[D]: DsnDDteDvslfD RICH_[DE]: DsnDDtEDvslfDaEEE RICH_fLPS_[D]: qqDsnDDteDvslfD RICH_MOBI_[D]: DsnDDteDvslfD RICH_MOBI_[DE]: DsnDDtEDvslfDaEEE RICH_fLPS_MOBI_[D]: qqDsnDDteDvslfD
120 140 160 180 200 AA: KSHWVFESRKESSQENKTVSEAESRIFWLGLIACPVLWVIFAFSALFSFRVKWLAVVIMGVVLQGANLYGYIRCKVRSRKHLTSMATSYFGKQFLRQNTG STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...............................................................................................DDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: .............................................................................................DDDDDDD CONSENSUS: ......................... ..... .......................DDDDD CONSENSUS_MOBI: ......................... ..... ............................
AA: DDQTS STMI: DO_DISOPRED3: DDDDD DO_IUPRED2A: ....D DO_SPOTD: DDDDD CONSENSUS: DDDDD CONSENSUS_MOBI: .....