P61254 RL26_HUMAN
Gene name: RPL26
Protein name: 60S ribosomal protein L26
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- mitotic cell cycle GO:0000278
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- response to stress GO:0006950
- ribosome biogenesis GO:0042254
- signal transduction GO:0007165
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P46721 | SLCO1A2 | 0.89341 | transport GO:0006810 |
| 2 | O14818 | PSMA7 | 0.88883 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 3 | O14604 | TMSB4Y | 0.86202 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 |
| 4 | Q9BYD6 | MRPL1 | 0.86103 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
| 5 | Q14331 | FRG1 | 0.84301 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 6 | Q05901 | CHRNB3 | 0.83113 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 7 | P53618 | COPB1 | 0.81982 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 protein transport GO:0015031 ... |
| 8 | Q9H169 | STMN4 | 0.81231 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cytoskeleton organization GO:0007010 |
| 9 | P62328 | TMSB4X | 0.79989 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q9Y2A7 | NCKAP1 | 0.78569 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell death GO:0008219 ... |
20 40 60 80 100 AA: MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: ...DDDDDDDDDDDDDDDDDDDDDDDD..DDDD..DDD.DDDDDDD....D.D.DD..................................DDDDDDDD.. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[NR]: RskNRkRhfN
120 140 AA: PSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKMQE STMI: DO_DISOPRED3: .............................DDDDD..DDD.....D DO_IUPRED2A: ................DD.DDDDDDDDDDDDDDDDDD.DDDD... DO_SPOTD: ......................DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ......................DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..................................DDDDDDDDDDD RICH_[E]: EkgkykEEtiEkmqE RICH_[K]: KsrqvgKeKgKyKeetieK RICH_[EK]: KsrqvgKEKgKyKEEtiEKmqE RICH_fLPS_[K]: aKsrqvgKeKgKyKeetieK