Q56A73 SPIN4_HUMAN
Gene name: SPIN4
Protein name: Spindlin-4
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8WV37 | ZNF480 | 0.77139 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q9NV72 | ZNF701 | 0.68333 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q9HBE4 | IL21 | 0.66383 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 4 | Q92466 | DDB2 | 0.64582 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 5 | Q8IZU8 | DSEL | 0.63661 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 6 | Q6GMV3 | PTRHD1 | 0.63636 | |
| 7 | Q5T2T1 | MPP7 | 0.63597 | cell junction organization GO:0034330 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 8 | P62266 | RPS23 | 0.58962 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q15388 | TOMM20 | 0.58146 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 10 | P10646 | TFPI | 0.56445 | response to stress GO:0006950 |
20 40 60 80 100 AA: MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEI STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ DO_IUPRED2A: DDDDDDD....DD...DD.DDDDD..DDDDDDDD.................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KKrhthrKqrrK RICH_[KR]: KKRhthRKqRRK RICH_[MV]: MspptVppMgVdgV
120 140 160 180 200 AA: LPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ................................................................................................D..D DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ............................................................................................DDDDD...
220 240 AA: VGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP STMI: DO_DISOPRED3: ................................................. DO_IUPRED2A: ................................................. DO_SPOTD: ................................................D CONSENSUS: ................................................. CONSENSUS_MOBI: ..............................................DDD