Q6GMV3 PTRD1_HUMAN
Gene name: PTRHD1
Protein name: Putative peptidyl-tRNA hydrolase PTRHD1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P25800 | LMO1 | 0.78087 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q53H54 | TRMT12 | 0.70711 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q56A73 | SPIN4 | 0.63636 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 reproduction GO:0000003 |
| 4 | Q01959 | SLC6A3 | 0.56294 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | O43827 | ANGPTL7 | 0.43476 | anatomical structure development GO:0048856 extracellular matrix organization GO:0030198 response to stress GO:0006950 |
| 6 | Q5SGD2 | PPM1L | 0.43443 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 7 | Q13336 | SLC14A1 | 0.4264 | transmembrane transport GO:0055085 transport GO:0006810 |
| 8 | P10632 | CYP2C8 | 0.36602 | biosynthetic process GO:0009058 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 9 | Q16696 | CYP2A13 | 0.35755 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 10 | Q9H3F6 | KCTD10 | 0.35698 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MHRGVGPAFRVVRKMAASGAEPQVLVQYLVLRKDLSQAPFSWPAGALVAQACHAATAALHTHRDHPHTAAYLQELGRMRKVVLEAPDETTLKELAETLQQ STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: .........................................................DDD.........D.......................DDD.... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[MV]: MhrgVgpafrVVrkM
120 AA: KNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK STMI: DO_DISOPRED3: ........................................ DO_IUPRED2A: ........................................ DO_SPOTD: ........................................ CONSENSUS: ........................................ CONSENSUS_MOBI: ........................................