P26373 RL13_HUMAN
Gene name: RPL13
Protein name: 60S ribosomal protein L13
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H7R5 | ZNF665 | 0.82848 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q9H845 | ACAD9 | 0.73929 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 small molecule metabolic process GO:0044281 |
| 3 | Q5JQF7 | LINC01556 | 0.73637 | |
| 4 | Q14197 | MRPL58 | 0.72735 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 5 | A6NJ08 | MBD3L5 | 0.71963 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | P0CG22 | DHRS4L1 | 0.71827 | |
| 7 | Q6T310 | RASL11A | 0.70247 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 |
| 8 | Q96LR9 | APOLD1 | 0.68641 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 9 | Q9NUL7 | DDX28 | 0.68159 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ribonucleoprotein complex assembly GO:0022618 ... |
| 10 | P33681 | CD80 | 0.68078 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDP STMI: DO_DISOPRED3: DDDDDDD............................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDD..............DDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD..................................DDDDDDD DO_SPOTD: DDDDDDDDD............DD....DDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. CONSENSUS: DDDDDDDDD...................DDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. CONSENSUS_MOBI: D................................................................................................... RICH_[AR]: ARkiRRRkARqAkARRiApRpA RICH_[A]: ArqAkArriAprpA RICH_[R]: RkiRRRkaRqakaRRiapR RICH_[IR]: IRRRkaRqakaRRI RICH_fLPS_[R]: aRkiRRRkaRqakaRRiapR
120 140 160 180 200 AA: RRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAK STMI: DO_DISOPRED3: ...................................................................................................D DO_IUPRED2A: DDDDDDDDDDDDDD.............DDDDDD.DDDDDDDDDDDD..D.......D.......D................................... DO_SPOTD: ...............................DDDDDDDDDDD.................................................DDDDDDDDD CONSENSUS: ...............................DDDDDDDDDDD.........................................................D CONSENSUS_MOBI: ....................................................................................................
AA: EAAEQDVEKKK STMI: DO_DISOPRED3: DDDDDDDDDDD DO_IUPRED2A: .DDDDDDDDDD DO_SPOTD: DDDDDDDDDDD CONSENSUS: DDDDDDDDDDD CONSENSUS_MOBI: ...........