Q5JQF7 CF100_HUMAN

Gene name: LINC01556
Protein name: Putative uncharacterized protein encoded by LINC01556

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NRR3 CDC42SE2 0.9113 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
signal transduction GO:0007165
...
2 Q14197 MRPL58 0.90699 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
3 Q6T310 RASL11A 0.86806 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
signal transduction GO:0007165
4 O60762 DPM1 0.82877 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
5 P33681 CD80 0.82312 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
6 Q9NUL7 DDX28 0.80408 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
ribonucleoprotein complex assembly GO:0022618
...
7 Q9H7R5 ZNF665 0.77671 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 Q15036 SNX17 0.77586 anatomical structure development GO:0048856
catabolic process GO:0009056
protein transport GO:0015031
...
9 Q9Y3A4 RRP7A 0.76266 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cellular component assembly GO:0022607
...
10 Q9Y2E5 MAN2B2 0.7581 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular protein modification process GO:0006464
...

                                           20                  40                  60                  
AA:                      MLQVVQEGNPAPFIINTVKRGRRDRERQRTPWAPHPLGFQGRRYIYESPNHRGKDSSFLAQK
STMI:                                                                                  
DO_DISOPRED3:            .............................................................D
DO_IUPRED2A:             DDD........DDDDDDDDDDDDDDDDDDDDDDDD.......DDDDDD.DDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDD...DDDDDDDDDDDDDDD.DDD.............DDDDDDDDDDDDDD
CONSENSUS:               DDD........DDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDD
CONSENSUS_MOBI:          ..............................................................
RICH_[R]:                                   RgRRdReRqR                                 
RICH_[IR]:                            IIntvkRgRRdReR                                   
RICH_fLPS_[R]:                      pfiintvkRgRRdReRqRtp