P29275 AA2BR_HUMAN
Gene name: ADORA2B
Protein name: Adenosine receptor A2b
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H223 | EHD4 | 0.89443 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 protein-containing complex assembly GO:0065003 ... |
| 2 | Q92911 | SLC5A5 | 0.87622 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | Q8NHA8 | OR1F12 | 0.83957 | signal transduction GO:0007165 |
| 4 | P04629 | NTRK1 | 0.81373 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q14240 | EIF4A2 | 0.7928 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9NRM2 | ZNF277 | 0.76822 | response to stress GO:0006950 |
| 7 | P36406 | TRIM23 | 0.76597 | biological process involved in symbiotic interaction GO:0044403 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 8 | Q5T319 | FAM182B | 0.72161 | |
| 9 | Q9NWW5 | CLN6 | 0.70711 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 homeostatic process GO:0042592 ... |
| 10 | Q9Y263 | PLAA | 0.70711 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVA STMI: MMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD................................................................................................ CONSENSUS: DDDD.... .......... ........... CONSENSUS_MOBI: ........ .......... ...........
120 140 160 180 200 AA: VDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLV STMI: M MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ........................................................D..D........................................ DO_IUPRED2A: ......................................................D............................................. DO_SPOTD: .............................................DDDDDDDDDDDD.DDDD...................................... CONSENSUS: .................... ..........DDDDDD.................. CONSENSUS_MOBI: .................... ..................................
220 240 260 280 300 AA: IYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT STMI: MMM MMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: ................DDDDDDDD............................................................................ CONSENSUS: ................................ ........ ......... CONSENSUS_MOBI: ................................ ........ .........
320 AA: FHKIISRYLLCQADVKSGNGQAGVQPALGVGL STMI: DO_DISOPRED3: .............DDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ................................ DO_SPOTD: ............DDDDDDDDDDDDDDDDDDDD CONSENSUS: .............DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................ RICH_[G]: GnGqaGvqpalGvG