Q9NWW5 CLN6_HUMAN
Gene name: CLN6
Protein name: Ceroid-lipofuscinosis neuronal protein 6
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- homeostatic process GO:0042592
- nervous system process GO:0050877
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96FZ5 | CMTM7 | 0.92245 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 |
| 2 | P23942 | PRPH2 | 0.87538 | anatomical structure development GO:0048856 cell adhesion GO:0007155 nervous system process GO:0050877 |
| 3 | Q93098 | WNT8B | 0.8288 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 4 | Q9H2S5 | RNF39 | 0.82684 | cellular protein modification process GO:0006464 |
| 5 | Q9GZN4 | PRSS22 | 0.82202 | |
| 6 | Q7RTY9 | PRSS41 | 0.8165 | |
| 7 | Q6V0L0 | CYP26C1 | 0.81489 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q5T0D9 | TPRG1L | 0.79115 | cell-cell signaling GO:0007267 |
| 9 | Q9H2C2 | ARV1 | 0.78558 | biosynthetic process GO:0009058 membrane organization GO:0061024 plasma membrane organization GO:0007009 ... |
| 10 | O95672 | ECEL1 | 0.76586 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MEATRRRQHLGATGGPGAQLGASFLQARHGSVSADEAARTAPFHLDLWFYFTLQNWVLDFGRPIAMLVFPLEWFPLNKPSVGDYFHMAYNVITPFLLLKL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. DO_IUPRED2A: ....DDDDD..D........................................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................... .... CONSENSUS_MOBI: ....................................................... .... RICH_[AG]: AtrrrqhlGAtGGpGAqlGA RICH_[G]: GatGGpGaqlGasflqarhG
120 140 160 180 200 AA: IERSPRTLPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNLKPETLIDSFELLYYYDEYLGHCMWYIPFFLILFMYFSGCFTAS STMI: M MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ......... ............................................... . CONSENSUS_MOBI: ......... ............................................... .
220 240 260 280 300 AA: KAESLIPGPALLLVAPSGLYYWYLVTEGQIFILFIFTFFAMLALVLHQKRKRLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPW STMI: MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ... .............. .................... CONSENSUS_MOBI: ... .............. ....................
AA: AFYTLHVSSRH STMI: DO_DISOPRED3: ..........D DO_IUPRED2A: ........... DO_SPOTD: ........DDD CONSENSUS: ..........D CONSENSUS_MOBI: ...........