P30405 PPIF_HUMAN
Gene name: PPIF
Protein name: Peptidyl-prolyl cis-trans isomerase F, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- cellular protein modification process GO:0006464
- generation of precursor metabolites and energy GO:0006091
- membrane organization GO:0061024
- protein folding GO:0006457
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q02363 | ID2 | 0.90348 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 2 | Q8TAG5 | VSTM2A | 0.90286 | cell differentiation GO:0030154 cell population proliferation GO:0008283 |
| 3 | P15907 | ST6GAL1 | 0.90016 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | Q16445 | GABRA6 | 0.89443 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 5 | P41586 | ADCYAP1R1 | 0.89443 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 6 | Q9NPH3 | IL1RAP | 0.89004 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 7 | Q7Z7C7 | STRA8 | 0.88822 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 8 | P59773 | MINAR2 | 0.87416 | |
| 9 | P28336 | NMBR | 0.87179 | signal transduction GO:0007165 |
| 10 | Q9ULD0 | OGDHL | 0.86824 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIP STMI: TTTTTTTTTTTTTTTTTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... DO_IUPRED2A: ................................DDDDDD..D........................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS: DDDDDDDDDDDDD.......................................................... CONSENSUS_MOBI: ....................................................................... RICH_[S]: SkgSgdpSSSSS
120 140 160 180 200 AA: SFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVI STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..........................................D......................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: TDCGQLS STMI: DO_DISOPRED3: ....... DO_IUPRED2A: ....... DO_SPOTD: ...DDDD CONSENSUS: ....... CONSENSUS_MOBI: .......