P48788 TNNI2_HUMAN

Gene name: TNNI2
Protein name: Troponin I, fast skeletal muscle

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- circulatory system process GO:0003013

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96JF6 ZNF594 0.85212
2 Q9Y5N6 ORC6 0.74695 biosynthetic process GO:0009058
cell cycle GO:0007049
cell division GO:0051301
...
3 Q8N9W8 FAM71D 0.73724
4 Q6UWZ7 ABRAXAS1 0.69811 cell cycle GO:0007049
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
5 P16949 STMN1 0.69247 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
6 Q7Z4B0 LINC00305 0.69213
7 A6NCM1 IQCA1L 0.68725
8 Q96EA4 SPDL1 0.68047 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
9 Q9NYU2 UGGT1 0.674 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
10 Q14512 FGFBP1 0.66993 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell population proliferation GO:0008283
...

                                           20                  40                  60                  80                 100
AA:                      MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDD..............................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDD..........DDD.DDDDDDDDDDDDDDDDDDDDDDDDD..DD..DD.................DDDDDDDDDDDDDD..DD....
DO_SPOTD:                DDDDDDDDDDDDDD..............................................................................D.....DD
CONSENSUS:               DDDDDDDDDDDDDD......................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140                 160                 180                  
AA:                      FDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES
STMI:                                                                                                      
DO_DISOPRED3:            ..........................................D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             D..D.......D.DD............................DDDDDDD.DDDDDDDDDDDDDDDD.DDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDD....D.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD.......DDD............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .............................................................DDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                                               DtekerDlrDvgD                      
RICH_[K]:                                                            KKedteKerdlrdvgdwrK                   
RICH_[DE]:                                                             EDtEkErDlrDvgDwrkniEE               
RICH_[DK]:                                                           KKeDteKerDlrDvgDwrK                   
RICH_[DR]:                                                                   RDlRDvgDwR                    
RICH_[EK]:                                                                             KniEEKsgmEgrKKmfEsE 
RICH_[KM]:                                                                                  KsgMegrKKM     
RICH_MOBI_[K]:                                                                         KnieeKsgmegrKK      
RICH_MOBI_[EK]:                                                                        KniEEKsgmEgrKKmfEsE 
RICH_MOBI_[EM]:                                                                           EEksgMEgrkkMfEsE 
RICH_MOBI_[KM]:                                                                        KnieeKsgMegrKKM