P49685 GPR15_HUMAN
Gene name: GPR15
Protein name: G-protein coupled receptor 15
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- immune system process GO:0002376
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5T7M9 | DIPK1A | 0.81923 | |
| 2 | P56750 | CLDN17 | 0.66227 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 3 | Q9NR97 | TLR8 | 0.63971 | cellular protein modification process GO:0006464 immune system process GO:0002376 response to stress GO:0006950 ... |
| 4 | Q8NCR3 | MFI | 0.60837 | anatomical structure development GO:0048856 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 5 | P54762 | EPHB1 | 0.5989 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 6 | Q9UKJ0 | PILRB | 0.57346 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 7 | Q9UIB8 | CD84 | 0.56661 | catabolic process GO:0009056 cell adhesion GO:0007155 immune system process GO:0002376 ... |
| 8 | Q8IWA5 | SLC44A2 | 0.55514 | biosynthetic process GO:0009058 immune system process GO:0002376 signal transduction GO:0007165 ... |
| 9 | Q8NE65 | ZNF738 | 0.51698 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 10 | P35609 | ACTN2 | 0.50782 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWR STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDD............. ............... .......... CONSENSUS_MOBI: ................................. ............... .......... RICH_fLPS_[Y]: mdpeetsvYldYYYatspns
120 140 160 180 200 AA: TGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVAL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................... ........ ...................... CONSENSUS_MOBI: .................... ........ ......................
220 240 260 280 300 AA: IFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPF STMI: MMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: ...........................DDDDDDDDDDD.............................................................. CONSENSUS: .......................... ........................ CONSENSUS_MOBI: .......................... ........................
320 340 AA: IYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL STMI: MMMMM DO_DISOPRED3: ........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ............................................................ DO_SPOTD: ......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................................... RICH_[T]: TeTsdshlTkalsT