P55854 SUMO3_HUMAN

Gene name: SUMO3
Protein name: Small ubiquitin-related modifier 3

List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NR50 EIF2B3 0.88774 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 P32456 GBP2 0.78488 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
3 O95302 FKBP9 0.76822 protein folding GO:0006457
4 Q8TCT8 SPPL2A 0.73994 immune system process GO:0002376
signal transduction GO:0007165
5 Q00688 FKBP3 0.71778
6 Q8TAA3 PSMA8 0.70711 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 A6NHJ4 ZNF860 0.67572 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 P46721 SLCO1A2 0.647 transport GO:0006810
9 Q9NS73 MBIP 0.63372 cellular protein modification process GO:0006464
chromosome organization GO:0051276
response to stress GO:0006950
...
10 P53618 COPB1 0.61396 biological process involved in symbiotic interaction GO:0044403
immune system process GO:0002376
protein transport GO:0015031
...

                                           20                  40                  60                  80                 100
AA:                      MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDD..........................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDD..................................................................................DDDDD
CONSENSUS:               DDDDDDDDDDDDD..................................................................................DDDDD
CONSENSUS_MOBI:          ................................................................................................DDDD
RICH_[EK]:                 EEKpKEgvKtE                                                                                       

                                          
AA:                      HSF
STMI:                       
DO_DISOPRED3:            DDD
DO_IUPRED2A:             DDD
DO_SPOTD:                DDD
CONSENSUS:               DDD
CONSENSUS_MOBI:          DDD