Q8TAA3 PSMA8_HUMAN
Gene name: PSMA8
Protein name: Proteasome subunit alpha-type 8
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- nucleobase-containing compound catabolic process GO:0034655
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O14818 | PSMA7 | 0.8165 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 2 | Q14331 | FRG1 | 0.7941 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 3 | Q05901 | CHRNB3 | 0.77557 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 4 | P61254 | RPL26 | 0.74952 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q9BYD6 | MRPL1 | 0.74316 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
| 6 | Q6ZW05 | PTCHD4 | 0.71582 | |
| 7 | Q9Y287 | ITM2B | 0.70711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 |
| 8 | Q9HCP6 | HHATL | 0.70711 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 9 | O14604 | TMSB4Y | 0.69652 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 |
| 10 | P46721 | SLCO1A2 | 0.67535 | transport GO:0006810 |
20 40 60 80 100 AA: MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALDDHVCMAFAVLTIFIGLTADARVVINRARVECQ STMI: DO_DISOPRED3: DDD................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD................................................................................................. CONSENSUS: DDD................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: SHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAIASDSEAIKLAI STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: KALLEVVQSGGKNIELAIIRRNQPLKMFSAKEVELYVTEIEKEKEEAEKKKSKKSV STMI: DO_DISOPRED3: ............................................DDDDDDDDDDDD DO_IUPRED2A: ..............................................DDDDDDDDDD DO_SPOTD: ............................................DDDDDDDDDDDD CONSENSUS: ............................................DDDDDDDDDDDD CONSENSUS_MOBI: ........................................................ RICH_[EK]: EEaEKKKsKK RICH_fLPS_[K]: eeaeKKKsKK