P57054 PIGP_HUMAN
Gene name: PIGP
Protein name: Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BQS7 | HEPH | 0.53 | homeostatic process GO:0042592 transport GO:0006810 |
| 2 | P05177 | CYP1A2 | 0.50767 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 3 | P00387 | CYB5R3 | 0.49862 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 circulatory system process GO:0003013 ... |
| 4 | O60783 | MRPS14 | 0.48809 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 5 | P37058 | HSD17B3 | 0.4559 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 reproduction GO:0000003 ... |
| 6 | Q99679 | GPR21 | 0.44682 | growth GO:0040007 homeostatic process GO:0042592 signal transduction GO:0007165 |
| 7 | P10632 | CYP2C8 | 0.41831 | biosynthetic process GO:0009058 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 8 | O43174 | CYP26A1 | 0.41684 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | P0C851 | PIRT | 0.40825 | response to stress GO:0006950 signal transduction GO:0007165 transmembrane transport GO:0055085 ... |
| 10 | A6NH11 | GLTPD2 | 0.37488 | membrane organization GO:0061024 transport GO:0006810 |
20 40 60 80 100 AA: MVPRSTSLTLIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGI STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........ ................... CONSENSUS_MOBI: ....................................... ................... RICH_[FL]: LtLivFLFhrL
120 140 AA: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN STMI: DO_DISOPRED3: .......................................................DDD DO_IUPRED2A: .......................................................... DO_SPOTD: ....................................................DDDDDD CONSENSUS: .......................................................DDD CONSENSUS_MOBI: ..........................................................